PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma83g00280.1
Common NameZOSMA_83G00280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 191aa    MW: 21908.7 Da    PI: 9.335
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma83g00280.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.93.5e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++ rqvtf+kRrng+lKKA+ELSvLCdae+a+++fss+g+lyeys+
  Zosma83g00280.1  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEIALVVFSSRGRLYEYSN 59
                     79***********************************************95 PP

2K-box41.46.3e-1558143590
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                      s++s +++ +++ + ++++ ++     +     + G++++sL++keL+qLe++Le+++++iRskK+  + +    l+ k  e++++
  Zosma83g00280.1  58 SNNSIKSTIEKYKKSHADNSRSSRPIVEIDTQAFNGDSVSSLNVKELKQLETRLERGISRIRSKKELEIQNDNMFLKAKISENEKA 143
                      5566666667777777777777777888888899**********************************999999999998877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.459161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.28E-32273IPR002100Transcription factor, MADS-box
CDDcd002653.29E-43275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-32323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-323859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.9359163IPR002487Transcription factor, K-box
PfamPF014863.8E-885146IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEIALVVFSS RGRLYEYSNN  60
SIKSTIEKYK KSHADNSRSS RPIVEIDTQA FNGDSVSSLN VKELKQLETR LERGISRIRS  120
KKELEIQNDN MFLKAKISEN EKALQQESIV HVGVDQFDDL QMFDSRNYFS NVDSHYPLHP  180
QQDHTTLHLG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-22185186Myocyte-specific enhancer factor 2B
1tqe_Q5e-22185186Myocyte-specific enhancer factor 2B
1tqe_R5e-22185186Myocyte-specific enhancer factor 2B
1tqe_S5e-22185186Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781978.11e-81PREDICTED: MADS-box transcription factor 3-like
RefseqXP_008781979.11e-81PREDICTED: MADS-box transcription factor 3-like
RefseqXP_008786400.13e-81PREDICTED: MADS-box transcription factor 3 isoform X2
SwissprotQ407043e-67MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0K9NM351e-139A0A0K9NM35_Z
STRINGGSMUA_Achr7P23690_0011e-79(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.21e-68MIKC_MADS family protein